DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and rbm34

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001004890.1 Gene:rbm34 / 448232 XenbaseID:XB-GENE-5895036 Length:412 Species:Xenopus tropicalis


Alignment Length:207 Identity:48/207 - (23%)
Similarity:80/207 - (38%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NNSLNNLCGLSLGSGGSDDLMNDPRASNTN-----------LIVNYLPQDMTDRELYALFRAIGP 142
            |.||::           |.::..||....|           :.|..||.|.|.:.|.:||:..|.
 Frog   140 NQSLDD-----------DGVVVQPRKRKVNRAEERIKNKRTVFVGNLPADYTKQMLKSLFKEFGH 193

  Fly   143 INTCR-----------------IMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNK-RLK 189
            |.:.|                 |.|..........|::.|..|..:.:|:| .||..|.:. .::
 Frog   194 IESMRFRSVARAEANLSRKVAAIQRKVHPKRKNINAYIVFKDESSASQALK-RNGAEVGSGFHIR 257

  Fly   190 VSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKR 254
            |..|..........:.::.|||..|.::.:...|.:.|.:....|:||:.||..:|..:|.:...
 Frog   258 VDIASKRSSHDNKRSAFIGNLPYEIEEEAVRDHFSECGKVQGVRIIRDQKTGIGKGFGYVLFESA 322

  Fly   255 EEAQEAISALNN 266
            :..|.|:. |||
 Frog   323 DAVQLALK-LNN 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/108 (22%)
RRM2_Hu_like 203..281 CDD:240822 18/64 (28%)
rbm34NP_001004890.1 RRM1_RBM34 168..259 CDD:240840 21/91 (23%)
RRM2_RBM34 272..344 CDD:240841 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.