DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and tra2a

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_012819962.1 Gene:tra2a / 448073 XenbaseID:XB-GENE-492325 Length:341 Species:Xenopus tropicalis


Alignment Length:169 Identity:42/169 - (24%)
Similarity:64/169 - (37%) Gaps:47/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RGFGMSHSLPSGMDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLN 93
            |....|||......:....|....||..:..|.......||..||          |.       .
 Frog    65 RSRSRSHSRKRRSKSRSYTPEYRRRRSRSHSPMSNRRRHNGSRAN----------PD-------P 112

  Fly    94 NLC----GLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKT 154
            |:|    ||||.:                          |:|:|..:|...||::...::.|.:|
 Frog   113 NICIGVFGLSLYT--------------------------TERDLREVFSRYGPLSGVNVVYDQRT 151

  Fly   155 GYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYA 193
            |.|.|:|||.|....||:.|::..||:.:..:|::|.|:
 Frog   152 GRSRGFAFVYFERIEDSREAMEHANGMELDGRRIRVDYS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 23/77 (30%)
RRM2_Hu_like 203..281 CDD:240822
tra2aXP_012819962.1 RRM <98..>190 CDD:223796 33/134 (25%)
RRM_TRA2 115..192 CDD:240809 28/102 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.