DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and elavl1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001005461.1 Gene:elavl1 / 448062 XenbaseID:XB-GENE-481800 Length:326 Species:Xenopus tropicalis


Alignment Length:203 Identity:90/203 - (44%)
Similarity:133/203 - (65%) Gaps:3/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SGGSDDLMND---PRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFV 163
            |.|..|.|:|   .....||||||||||:||..||.:||.:||.:.:.:::||...|:|.||.||
 Frog     2 SNGYGDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFV 66

  Fly   164 DFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGS 228
            ::.:..|::|||..|||:.:::|.:|||.|||..|||||.|||::.||||:|...::.:|..:|.
 Frog    67 NYLNAKDAERAINTLNGLRLQSKTIKVSVARPSSESIKDANLYISGLPRTMTQKDVEDMFLPFGR 131

  Fly   229 IVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFM 293
            |:...:|.|:.||..|||||:|::||.||:|||::.|...|.|.|:|::|:.|....:.|....:
 Frog   132 IINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKNMALL 196

  Fly   294 SQMGVVPA 301
            ||:...||
 Frog   197 SQLCHSPA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 40/79 (51%)
RRM2_Hu_like 203..281 CDD:240822 34/77 (44%)
elavl1NP_001005461.1 RRM 19..326 CDD:330708 85/186 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.