DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and elavl2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001002172.2 Gene:elavl2 / 431719 ZFINID:ZDB-GENE-040704-9 Length:389 Species:Danio rerio


Alignment Length:319 Identity:108/319 - (33%)
Similarity:165/319 - (51%) Gaps:57/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGMDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLG-S 102
            :.|:|:.|           :.|.|..|.|                     .||::|.|...:. .
Zfish    28 AAMETQLS-----------NGPSCTSSNG---------------------PNSVSNTCTSPVEMP 60

  Fly   103 GGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTS 167
            .||:|       |.||||||||||:||..||.:||.:||.|.:|:::||..||.|.||.||::..
Zfish    61 NGSED-------SKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYME 118

  Fly   168 EMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQK 232
            ..|:::||..|||:.::.|.:|||||||...||:|.||||:.||:|:|..:|:.:|.::|.|:..
Zfish   119 PKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQFGRIITS 183

  Fly   233 NILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMG 297
            .||.|::||..|||.|:|:::|.||:|||..||...|.|.::|::|:.|....:..:...:|.:.
Zfish   184 RILVDQVTGVSRGVGFIRFDRRVEAEEAIKGLNGQKPPGATEPITVKFANNPSQKSSQALLSHLY 248

  Fly   298 VVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGL 356
            ..|..   ..|.|.|..|..|.:              |.:.:..:|:.|......:||:
Zfish   249 QSPNR---RYPGPLAQQAQRFRL--------------DNLLNMAYGVKSRFSPMTIDGV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 43/79 (54%)
RRM2_Hu_like 203..281 CDD:240822 34/77 (44%)
elavl2NP_001002172.2 ELAV_HUD_SF 65..388 CDD:273741 95/250 (38%)
RRM1_Hu 67..144 CDD:241094 39/76 (51%)
RRM2_HuB 149..238 CDD:241219 38/88 (43%)
RRM_SF 303..388 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.