DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and eIF3g2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_650887.1 Gene:eIF3g2 / 42422 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster


Alignment Length:118 Identity:34/118 - (28%)
Similarity:54/118 - (45%) Gaps:16/118 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 HLPPMASNNSLNNLCGLS----LGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGP 142
            ::||...:..     |:|    .|.|...|..:..|.||       |.:.||:.:|..|.:.|||
  Fly   166 YVPPFMKDGG-----GISGSKNWGRGRDRDDSSAVRISN-------LSESMTETDLEELVKKIGP 218

  Fly   143 INTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARP 195
            .....:.|:..:|...|:|:|.|....|:..||:||||....:..|.|.:::|
  Fly   219 HTKMYLAREKNSGLCKGFAYVHFKFRQDAAAAIEVLNGHGYDHLILCVEWSKP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/79 (30%)
RRM2_Hu_like 203..281 CDD:240822
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149
RRM <171..>256 CDD:223796 27/96 (28%)
RRM_eIF3G_like 194..270 CDD:240854 26/82 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.