DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CG5213

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:191 Identity:76/191 - (39%)
Similarity:112/191 - (58%) Gaps:1/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGI 181
            ||||:||||||||:.||:.||...|.|...:|:|..:||.|..|.|||:.||..:..|:..::|.
  Fly    41 TNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGY 105

  Fly   182 TVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGV 246
            ..|.|||||::|||.......::|||.|||..:.:.::..:|..||:||..|:||.|...|.|||
  Fly   106 ETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGV 170

  Fly   247 AFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFM-SQMGVVPANVPPP 306
            ||:::....:|:.|...::..:.||.|:||:|:..|...|..::... ||......:.|||
  Fly   171 AFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 40/79 (51%)
RRM2_Hu_like 203..281 CDD:240822 29/77 (38%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 37/75 (49%)
RRM 128..202 CDD:214636 28/73 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BKYN
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.