DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and sqd

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:199 Identity:54/199 - (27%)
Similarity:90/199 - (45%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLP 125
            |.|...|:.|:|.:..|         :|:|.       |..||..||        :..|.|..|.
  Fly    24 GPGSENGDAGAAGSTNG---------SSDNQ-------SAASGQRDD--------DRKLFVGGLS 64

  Fly   126 QDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTS--EMDSQRAI--KVLNGITVRNK 186
            .:.|::||...|...|.|.:..:..|.:||.|.|:||:.||:  .:|...|.  .::|...|..|
  Fly    65 WETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPK 129

  Fly   187 RLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRY 251
            :.|   ||.|       .::|..|...|:|:::.|.||::|:||:..:..||...:.:|..|:.:
  Fly   130 KAK---ARHG-------KIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

  Fly   252 NKRE 255
            :..:
  Fly   185 DSEQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/83 (31%)
RRM2_Hu_like 203..281 CDD:240822 14/53 (26%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 22/70 (31%)
RRM2_hnRNPD_like 137..211 CDD:240775 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.