DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CG2931

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:258 Identity:57/258 - (22%)
Similarity:96/258 - (37%) Gaps:84/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDD---------LMNDPR--------- 113
            |||||...:..      |||....:..:.. :..||||...         |.:.|:         
  Fly    54 GNGGSRLTVPP------PPMPPPPTFMSTF-VPTGSGGGSSKAMSATPVVLSSAPKLYQCRQSVH 111

  Fly   114 ----ASNTNLIVNYLPQDMTD--RELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQ 172
                |:..::.:|.:..|:|.  ::|.|......||                           ::
  Fly   112 VPTVAAAPSIDINAVSFDVTQKLKKLKAEKSGPNPI---------------------------AE 149

  Fly   173 RAIKVLNG--------ITVRNKRLKVSYARPGGESIKDTNL----------YVTNLPRTITDDQL 219
            .|||....        .|.|.|:.:.:....||...:||:|          :..:|...:.|:.|
  Fly   150 EAIKAARASSALQSFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDFRIFCGDLGNDVNDEVL 214

  Fly   220 DTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEG---GSQPLSVR 279
            ...|.|:.|..:..::|||.||:.:|..||.:  ||.| :.|.|:..:  :|   ||:|:.:|
  Fly   215 TRTFNKFPSFQRARVVRDKRTGKSKGFGFVSF--REPA-DFIRAMKEM--DGRYVGSRPIKLR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 13/89 (15%)
RRM2_Hu_like 203..281 CDD:240822 26/90 (29%)
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 24/86 (28%)
RRM <194..>280 CDD:223796 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.