DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and rbm14b

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:259 Identity:66/259 - (25%)
Similarity:105/259 - (40%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 RASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKV 177
            :.....|.|..|..|.|..||.|:|.:.|.:.:|.::|.        :|||....|..::|||:.
Zfish     3 KGHTVKLFVGNLALDTTQEELSAIFESYGQVVSCSVLRQ--------FAFVHLQGEGAAERAIRE 59

  Fly   178 LNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGR 242
            |||...:.:.|.|..:|  |..:..|.::|.||....|.:.|..:|..:|.:::    .||:   
Zfish    60 LNGREFKGRNLVVEESR--GRPLHSTKVFVGNLSSMCTTEDLQELFQTFGKVLE----CDKV--- 115

  Fly   243 PRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEH----------------------- 284
             :|.|||....:|:|.:||.||:....:|  :||||.|::..                       
Zfish   116 -KGYAFVHMENKEDALQAIEALHGTSFKG--RPLSVELSKVQPSKQTPTGKIPCVSCGKQGHYAG 177

  Fly   285 ----GKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGL 344
                ||.....:.||..|:.|........|.....:..|.::.       .|.||....|:.||
Zfish   178 ECPAGKPTLEQYQSQAAVLAAAAAAAAGLPLQVQQSVHNSVYN-------TSTFDPTYAALTGL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 25/79 (32%)
RRM2_Hu_like 203..281 CDD:240822 25/77 (32%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 24/75 (32%)
RRM1_2_CoAA_like 84..149 CDD:240789 23/74 (31%)
AIR1 <150..>187 CDD:331526 3/36 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.