DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and hnrnpa0

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_988923.1 Gene:hnrnpa0 / 394519 XenbaseID:XB-GENE-1000573 Length:309 Species:Xenopus tropicalis


Alignment Length:148 Identity:38/148 - (25%)
Similarity:72/148 - (48%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIK----VLN 179
            |.:..|....|:..|...|...|.:..|.::.:.:|..|..:.||.::|..::..|::    |::
 Frog    14 LFIGGLNVQTTEEGLRQHFETYGQLTDCVVVINPQTKRSRCFGFVTYSSAAEADAAVEASPHVVD 78

  Fly   180 GITVRNKRL--KVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGR 242
            |..|..||.  :...|:||..: |...|:|..|...:.:..|...|.::|::.:..|:.||::|:
 Frog    79 GNNVELKRAV
SREDSAKPGAHA-KVKKLFVGGLKEDVGESDLLEHFAQFGAVEKVEIIADKVSGK 142

  Fly   243 PRGVAFVRYNKREEAQEA 260
            .||..||.:...:.|.:|
 Frog   143 KRGFGFVYFTNHDSADKA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/83 (24%)
RRM2_Hu_like 203..281 CDD:240822 16/58 (28%)
hnrnpa0NP_988923.1 RRM1_hnRNPA0 10..88 CDD:240772 18/73 (25%)
RRM2_hnRNPA0 104..183 CDD:241023 16/57 (28%)
HnRNPA1 255..>275 CDD:314495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.