DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and hnrnpa1a

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_021335234.1 Gene:hnrnpa1a / 393467 ZFINID:ZDB-GENE-040426-1546 Length:445 Species:Danio rerio


Alignment Length:179 Identity:44/179 - (24%)
Similarity:76/179 - (42%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTC----------------------------RIMRDYKTG 155
            |.:..|..:.||..|.|.|...|.:..|                            ::|||..|.
Zfish    40 LFIGGLSFETTDESLRAHFEQWGTLTDCVVSPSAAIHMLMYEREEHLKVAGFLYCSQVMRDPNTK 104

  Fly   156 YSFGYAFVDFTS--EMDS---QRAIKVLNGITVRNKRL--KVSYARPGGES-IKDTNLYVTNLPR 212
            .|.|:.||.::|  |:|:   .|..|| :|..|..||.  :...::||..| :|  .::|..:..
Zfish   105 RSRGFGFVTYSSVGEVDAAMDARPHKV-DGRAVEPKRAVSR
EDSSKPGAHSTVK--KMFVGGIKE 166

  Fly   213 TITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 261
            ...::.|...||::|.|.:.||:.:|.:.:.||.||:.::..:.....:
Zfish   167 DTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRIV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 28/112 (25%)
RRM2_Hu_like 203..281 CDD:240822 13/59 (22%)
hnrnpa1aXP_021335234.1 RRM_SF 36..144 CDD:327398 27/104 (26%)
RRM_SF 157..233 CDD:327398 14/61 (23%)
HnRNPA1 376..>392 CDD:314495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.