DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and shep

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster


Alignment Length:283 Identity:80/283 - (28%)
Similarity:118/283 - (41%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SGGNGGSANNLG--GGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMND-----PRASNTNLIVN 122
            |..|..|::|.|  .|.:        :.||:|....:...|.:..:.|.     .:.|.|||.:.
  Fly   192 SNTNSSSSSNTGSQSGTL--------STSLSNTTNTNTNMGPNGTVQNQNQQGGEQLSKTNLYIR 248

  Fly   123 YLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKR 187
            .|.|..||::|..:....|.|.:.:.:.|..|....||.||||.....::.|:|.|.|..|:.:.
  Fly   249 GLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQAQM 313

  Fly   188 LKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYN 252
            .|.....|       ||||:.|||....:..|:.:..|||.:|...||||:.. ..:||.|.|..
  Fly   314 AKQQEQDP-------TNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARME 370

  Fly   253 KREEAQEAISALN-NVIPEGGSQPLSVRLAEEHGK-----------AKAAHFMSQMGV------- 298
            .||:.::.|...| |.|| |...||.|:.|:...|           |:|...:|..|:       
  Fly   371 SREKCEQIIQMFNGNTIP-GAKDPLLVKFADGGPKKKNLFKTPDPNARAWRDVSAEGIPVAYDPT 434

  Fly   299 -----VPANVPPPPPQPPAHMAA 316
                 |..||..|...|.:..:|
  Fly   435 MQQNGVSVNVGTPIGVPYSRFSA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 25/79 (32%)
RRM2_Hu_like 203..281 CDD:240822 31/78 (40%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689 23/69 (33%)
RRM2_MSSP 322..400 CDD:240690 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.