DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Pabpc1l

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001107551.1 Gene:Pabpc1l / 381404 MGIID:1922908 Length:607 Species:Mus musculus


Alignment Length:577 Identity:117/577 - (20%)
Similarity:200/577 - (34%) Gaps:196/577 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YNNKSSGGRGFGMSH----SLPSGMDTE-----FSFPSS--SSRRGYNDFPGCGGSGGNGGSANN 74
            ::::..|.|..||.:    :|.:.:|.:     ||...|  ||:..||:.    ||.|.|     
Mouse    86 WSHRDPGLRKSGMGNIFIKNLENSIDNKALYDTFSTFGSILSSKVVYNEH----GSRGFG----- 141

  Fly    75 LGGGNMCHLPP-MASNNSLNNLCGLSLGSGGSDDLMNDPRA--------------------SNTN 118
                 ..|... .|:..::|.:.|:         |:||.:.                    ..||
Mouse   142 -----FVHFETHEAAQKAINTMNGM---------LLNDRKVFVGHFKSRQKREAELGARALGFTN 192

  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITV 183
            :.|..|..::.::.|..||...|.:.:.::||| ..|.|.|:.||:|....::|:|:..:||..|
Mouse   193 IYVKNLHANVDEQRLQDLFSQFGNMQSVKVMRD-SNGQSRGFGFVNFEKHEEAQKAVDHMNGKEV 256

  Fly   184 RNKRLKVSYARPGGE------------------SIKDTNLYVTNLPRTITDDQLDTIFGKYGSIV 230
            ..:.|.|..|:...|                  ..:..||||.||..:|.|::|..:|..||.|.
Mouse   257 SGQLLYVGRAQKRAERQSELKRRFEQMKQERQNRYQGVNLYVKNLDDSINDERLKEVFSTYGVIT 321

  Fly   231 QKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQ 295
            ...::.:  :...:|..||.::..|||.:|::.:|..|.  |::||.|.||:...:.||      
Mouse   322 SAKVMTE--SSHSKGFGFVCFSSPEEATKAVTEMNGRIV--GTKPLYVALAQRKEERKA------ 376

  Fly   296 MGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRK 360
                                                                    :|...|||:
Mouse   377 --------------------------------------------------------ILTNQYRRR 385

  Fly   361 YHYPYLXLTPQQQQQLL----QHQQQALGFTSSSNNSI-------GNGNGNDNNM---------- 404
            ..:|.| ...|....||    |...||:.::|.|...:       ...:|..:..          
Mouse   386 PSHPVLSSFQQPTSYLLPAVPQSTAQAVYYSSGSITPMQPDPRWTAQPHGPPSTCPPAASVVQPL 450

  Fly   405 ---------LLYHQQYHQQQTQQQRLGNVAAHNISPNGSNNNINTSNTNNINFNTIRQNGVAALH 460
                     |....|...|....||:.|:......|.|..::|...       ..:...|.:|:|
Mouse   451 STTQHPCIHLRGASQVSSQVPHTQRVVNIGTQTTGPGGEGSSIPGQ-------LLVPHRGTSAVH 508

  Fly   461 YLQ--EQLQLQQPQDQQSQQQQPLT--MPSSPPFQQQSRQSHHNGSSSTLGNQLLAI 513
            ...  ::..:..|      ..||||  |.::.|..:|.:.         :|.:|.::
Mouse   509 SAHGVQESAVYVP------GHQPLTVSMLAAAPLHEQKQM---------IGERLYSL 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 25/79 (32%)
RRM2_Hu_like 203..281 CDD:240822 26/77 (34%)
Pabpc1lNP_001107551.1 PABP-1234 11..596 CDD:130689 117/577 (20%)
RRM1_I_PABPs 12..91 CDD:240824 0/4 (0%)
RRM2_I_PABPs 97..172 CDD:240825 22/97 (23%)
RRM3_I_PABPs 190..269 CDD:240826 25/79 (32%)
RRM4_I_PABPs 293..370 CDD:240827 28/80 (35%)
PABP 529..595 CDD:279051 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.