DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CG4806

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_611955.2 Gene:CG4806 / 37948 FlyBaseID:FBgn0260456 Length:657 Species:Drosophila melanogaster


Alignment Length:339 Identity:60/339 - (17%)
Similarity:122/339 - (35%) Gaps:100/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISA------ 263
            :::.|:|....|..|.....|:|.:....|.|..::|..:|.|||::..:|.|...:.|      
  Fly   232 VFIKNVPFDAEDADLRKACRKFGLVSYAIINRQAVSGHSKGTAFVKFKAKESADLCLQAGTEFKL 296

  Fly   264 LNNVI---PEGGSQPLSVRLAEEHGKAKAAH----FMSQMGVVPANVPPPPPQPPAHMAAAFNMM 321
            ::.|:   |....:.:..:.::|:.|..|..    ::::.|::              ||.|    
  Fly   297 MDEVLDPHPALSREEMKSKQSQENKKDDAKDSRNLYLAREGLI--------------MAGA---- 343

  Fly   322 HRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYLXLTPQQQQQLLQHQQQALGF 386
                             .|..|:.:.:.|         |.|.     ..|.:.|:|::..:   |
  Fly   344 -----------------KAADGVSASDMA---------KRHE-----LEQVKTQVLKNLNR---F 374

  Fly   387 TSSSNNSIGNGNGNDNN-----MLLYHQQYHQQQTQQQRLGNVAAHNISPNGSNNNINTSNTNNI 446
            .|.:..||.|...|.:|     |.|.:..:...:.:..|     .|.::|.....  .:.....:
  Fly   375 VSRNRLSIHNLPQNYDNEKLKQMALTYTGFRPHECRVMR-----EHKVTPEHPQG--KSKGFGFL 432

  Fly   447 NFNTIRQNGVAALHYLQEQ---------------------LQLQQPQDQQSQQQQPLTMPSSPPF 490
            :|:| .|..:|||..|...                     .::::.:.::|:|..| |..:....
  Fly   433 SFDT-HQRALAALRKLNNNPNIFGTQSRPIVAFSIEDRAVHKIKEKRTERSKQNNP-TYQNKQQE 495

  Fly   491 QQQSRQSHHNGSSS 504
            :::.||...||..:
  Fly   496 RKERRQQKRNGQET 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093
RRM2_Hu_like 203..281 CDD:240822 18/84 (21%)
CG4806NP_611955.2 RRM <2..>154 CDD:223796
RRM_SF 49..124 CDD:302621
RRM3_RBM28_like 230..306 CDD:240861 17/73 (23%)
RRM4_RBM28_like 379..468 CDD:240862 17/96 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.