DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CG4612

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:221 Identity:66/221 - (29%)
Similarity:100/221 - (45%) Gaps:31/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RRGYNDFPGCGGSGGNGGSAN---NLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRA 114
            |.|:|.. |.|.:..:..|||   .:|||      .:||        |.:.||||:..      .
  Fly    67 RHGHNSL-GSGHTSTSSHSANVGVGVGGG------ALAS--------GSTGGSGGNSS------P 110

  Fly   115 SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLN 179
            .:..:.:..|.:.:.::.:|..|...|.|..|.:.:| :.|.|.||.||.|.||..::.||:.:|
  Fly   111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVN 174

  Fly   180 GITVRNKRLKV--SYARPGGESIKDT---NLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKL 239
            |:...|:::.|  ...|...|..|.|   ||||.||....|:..|..:|..||.|....::.|: 
  Fly   175 GMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE- 238

  Fly   240 TGRPRGVAFVRYNKREEAQEAISALN 265
            .||.|...||.|...:.|..|:..|:
  Fly   239 EGRSRRFGFVAYENPQSALAAVIGLH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 23/81 (28%)
RRM2_Hu_like 203..281 CDD:240822 23/66 (35%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/70 (30%)
RRM3_I_PABPs 202..282 CDD:240826 22/64 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.