DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Elavl1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001102318.1 Gene:Elavl1 / 363854 RGDID:1308649 Length:326 Species:Rattus norvegicus


Alignment Length:204 Identity:89/204 - (43%)
Similarity:135/204 - (66%) Gaps:2/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LGSGGSDDLMNDPR--ASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAF 162
            :.:|..|.:..|.|  ...||||||||||:||..||.:||.:||.:.:.:::||...|:|.||.|
  Rat     1 MSNGYEDHMAEDCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGHSLGYGF 65

  Fly   163 VDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYG 227
            |::.:..|::|||..|||:.:::|.:|||||||..|.|||.|||::.||||:|...::.:|.::|
  Rat    66 VNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFG 130

  Fly   228 SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHF 292
            .|:...:|.|:.||..|||||:|::||.||:|||::.|...|.|.|:|::|:.|....:.|....
  Rat   131 RIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNMAL 195

  Fly   293 MSQMGVVPA 301
            :||:...||
  Rat   196 LSQLYHSPA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 41/79 (52%)
RRM2_Hu_like 203..281 CDD:240822 34/77 (44%)
Elavl1NP_001102318.1 ELAV_HUD_SF 19..326 CDD:273741 85/186 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.