DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and bru1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001260403.1 Gene:bru1 / 34648 FlyBaseID:FBgn0000114 Length:810 Species:Drosophila melanogaster


Alignment Length:502 Identity:111/502 - (22%)
Similarity:184/502 - (36%) Gaps:125/502 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMDTEFSFPSSSSRRGYNDFPGCGGSGGN 68
            ||||...|||        ||.|:|                      :||....|        .||
  Fly   258 NNNPSLLNNN--------NNNSNG----------------------TSSNNSLN--------VGN 284

  Fly    69 GGSANNLGGGNMCHLPPMASN---------NSLNNLCGL--SLGSGGSDDLM------------- 109
            ..|..:|||.|...|..:.||         |:.||.|..  ::.:...||..             
  Fly   285 NNSNPSLGGSNSNALVSVGSNGIMSAAGLVNNNNNPCSANRNVVAMVDDDACFRLDTDATVTYGE 349

  Fly   110 NDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRA 174
            .:|...|..:.|..:|:.|.:.:|..:|...|.:::..::||..||.|.|..||.|.:...:.:|
  Fly   350 KEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAALKA 414

  Fly   175 IKVLNGITVRNKRLKVSYARPG-GESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDK 238
            ...|:.:...|........:|. .|:..:..|:|..|.:.:.::.:..:|..:|:|.:..:|||:
  Fly   415 QDALHNVKTLNGMYHPIQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQ 479

  Fly   239 LTGRPRGVAFVRYNKREEAQEAISAL--NNVIPEGGSQPLSVRLAE---EHGKAKAAHFMSQMGV 298
             .|:.:|.|||.:..:..|..||...  .|.|.||.:.||.|:.|:   |..:.|.....:.:..
  Fly   480 -NGQSKGCAFVTFATKHAAISAIKVTLSQNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWN 543

  Fly   299 VPANV----------------PPPPPQP------PAHMAAAFNMMHRDGAMEKLRSLFDAICDAI 341
            :.:|:                |.||.||      .|...|:..::.:..|:    .|...:..|:
  Fly   544 LASNINIPLGQTATSVTTPILPNPPQQPSPVLGADAITPASIQLLQQLQAV----GLQHQLLQAL 604

  Fly   342 FGLDSENFADLLD-------GLYRRKYHYPYLXLTPQQQQQL------LQHQQQALGFTSSSNNS 393
            .||.::..:...|       ||           |||...|.|      .|.........:::..|
  Fly   605 TGLGAQQSSSATDTSAVAAAGL-----------LTPMTVQNLAAIAAMTQPSLSNAAAAAAAATS 658

  Fly   394 IGNGNGNDNNMLLYH------QQYHQQQTQQQRLGNVAAHNISPNGS 434
            .|:....:...||:.      ..|........:.|:.:|.:.||..|
  Fly   659 PGSAQLTNTAALLWSDPNPMASAYMSTAAGLPQFGSASALSTSPLAS 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 19/80 (24%)
RRM2_Hu_like 203..281 CDD:240822 24/79 (30%)
bru1NP_001260403.1 RRM1_CELF1_2_Bruno 356..437 CDD:241075 20/80 (25%)
ELAV_HUD_SF 359..808 CDD:273741 79/363 (22%)
RRM2_Bruno_like 443..524 CDD:241080 24/81 (30%)
RRM3_Bruno_like 722..800 CDD:241084
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.