DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and PABPC1L2A

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001012995.1 Gene:PABPC1L2A / 340529 HGNCID:27989 Length:200 Species:Homo sapiens


Alignment Length:152 Identity:47/152 - (30%)
Similarity:85/152 - (55%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGIT 182
            :|.|..|..::|:..||..|...|||.:.||.||..|..|.|||:|::...:|::||::.||...
Human     3 SLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDV 67

  Fly   183 VRNKRLKVSYAR--PGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRG 245
            ::.:.:::.:::  |........|:::.||.:||.:..|..||..:|:|:...:..|:  ..|:|
Human    68 IKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDE--KGPKG 130

  Fly   246 VAFVRYNKREEAQEAISALNNV 267
            ..||.:.|:|.|:.||..:|.:
Human   131 YGFVHFQKQESAERAIDVMNGM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/80 (33%)
RRM2_Hu_like 203..281 CDD:240822 21/65 (32%)
PABPC1L2ANP_001012995.1 PABP-1234 2..>196 CDD:130689 47/152 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.