DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and crp79

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001018242.1 Gene:crp79 / 3361521 PomBaseID:SPAC1610.03c Length:710 Species:Schizosaccharomyces pombe


Alignment Length:647 Identity:111/647 - (17%)
Similarity:193/647 - (29%) Gaps:232/647 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LSLGSGGSDDL----MNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMR--DYKTGY 156
            |::.|.|.:|:    :.:..||...|.:..||.::|..:||..|:..|.:....:.:  |.: |:
pombe   180 LTIPSLGLEDISMQVVPNAFASTLPLSILNLPAEVTPIDLYNHFKQAGVVKGTAVSQFLDQR-GF 243

  Fly   157 SFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSY------------ARPGGES---------- 199
            .:|...:|  |....|.||:.||.:..:...|:||.            ..|.|||          
pombe   244 RYGEVIMD--SVESCQNAIEKLNNVPYKGSILEVSIKNKASSSVKSIPTTPTGESLWPFPSENAN 306

  Fly   200 ----------------------------------------------------------------- 199
                                                                             
pombe   307 KTQINIENATCSKMTWIMGSPTKEKSQWGSVSTTGVSNQQNHPAAWNPDNKPQSIVHWDSLRESS 371

  Fly   200 -------IKDTNLYVTNLPRTI--TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKRE 255
                   |..:||||.||..|:  ...||:.:|..:|||:...:.....:|..:|..||.:.:.|
pombe   372 PSIPNSPIDPSNLYVKNLDDTVITCKSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAFRQIE 436

  Fly   256 EAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNM 320
            .|..|...||.::.  |.:.:.|..||...                                   
pombe   437 AAVRAKDTLNGMMV--GKKRIFVCFAERKS----------------------------------- 464

  Fly   321 MHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYLXLTPQQQQQLLQHQQQALG 385
                   :::|.|     .|.|.                  :.|.. .|.||..:.|..:.:...
pombe   465 -------DRIRRL-----QAFFA------------------NKPTSEQTAQQDNKALFVKPERSS 499

  Fly   386 FTS------SSNNSIGNGNGNDNNMLLYHQQYHQQQTQQQRLGNVAAHNISPNGSNNNINTSNTN 444
            ..:      ||.|.|     ::|...|..:..::.:.:       ...|..|:.:|..:|....|
pombe   500 TVTIRKPIESSTNKI-----SENPTTLSSKVENKNEPK-------TGENKEPSQTNEYVNCKQEN 552

  Fly   445 NINFNTIRQNGVAALHYLQEQLQLQQPQDQQSQQQQPLTMPSSPPFQQQSRQSHHNGSSSTLGNQ 509
                               ::|..|              :..:...::::.:..|:|....|...
pombe   553 -------------------KELSGQ--------------LSGNLDIKKEAGKLSHDGEQGNLLKP 584

  Fly   510 LLAISNNNSFNNNSNQSNSFTGNYSNGSAFTSNGAISGSNFPNNPTSSGNFTNNSTNSNPTNSGH 574
            |:..:|....|..|.:..|...|.........|..:|.:.|.....::...|.......|:   |
pombe   585 LVFHANTKLNNRGSAKMGSTATNLKKIQDMLHNKKLSNAYFVPRARATTCTTLTYVTVEPS---H 646

  Fly   575 FASNLAGSSNFTNHLSGSNNYTNSNGNFTSNAASSSNFSNNAASSTNYSKNCSSGVVGNSDP 636
            |.......|  ||.|| ...|.:|....|||....:::....::..|:   .|:..|.|:.|
pombe   647 FQDEDCNES--TNMLS-LVGYMDSYPEATSNIQKMNSYHIKDSNKENF---LSTTKVNNNSP 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/93 (24%)
RRM2_Hu_like 203..281 CDD:240822 24/79 (30%)
crp79NP_001018242.1 RRM_RBM18 18..106 CDD:240801
RRM 109..>289 CDD:223796 27/111 (24%)
RRM_SF 205..276 CDD:240668 19/73 (26%)
RRM2_I_PABPs 380..459 CDD:240825 24/80 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.