DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and CG11454

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster


Alignment Length:120 Identity:29/120 - (24%)
Similarity:46/120 - (38%) Gaps:8/120 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIM 149
            |...|.:.:.|.|..     .||...:.......|....|.:.:|:..||.:|...|||...||.
  Fly    43 PFLPNENGDQLVGQL-----EDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIP 102

  Fly   150 RDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTN 204
            .| ..|....:.||.:........|:.:..|:.:..|  ||:..:.||:.:...|
  Fly   103 TD-NNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQK--KVTIKQQGGKQLPAYN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/79 (25%)
RRM2_Hu_like 203..281 CDD:240822 1/2 (50%)
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 20/76 (26%)
RRM <70..210 CDD:223796 23/88 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.