DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and hnrnpa0a

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_997810.2 Gene:hnrnpa0a / 323529 ZFINID:ZDB-GENE-030131-2249 Length:305 Species:Danio rerio


Alignment Length:177 Identity:44/177 - (24%)
Similarity:77/177 - (43%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYS 157
            |.||.|.:|.                     |....||..|...|...|.:..|.::::.:...|
Zfish     7 NQLCKLFVGG---------------------LNVQTTDDGLRNHFEQYGKLTDCVVVQNQQLKRS 50

  Fly   158 FGYAFVDFTS--EMDSQRAIK--VLNGITVRNKRLKVSYARPGG---ESI-KDTNLYVTNLPRTI 214
            ..:.||.::|  |.||..:.:  :|:|   .|..||.:.||...   |:: |...:::..|...|
Zfish    51 RCFGFVTYSSPDEADSAMSARPHILDG---NNVELKRAVAREDAGKPEALAKVKKIFIGGLKDDI 112

  Fly   215 TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 261
            .:|.|...|.::|::.:..::.||.||:.||..||.:...:.|.:|:
Zfish   113 EEDHLRDCFSQFGAVEKAEVITDKETGKKRGFGFVYFEDNDSADKAV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 21/83 (25%)
RRM2_Hu_like 203..281 CDD:240822 16/59 (27%)
hnrnpa0aNP_997810.2 RRM1_hnRNPA0 8..86 CDD:240772 23/101 (23%)
RRM_SF 102..181 CDD:302621 16/58 (28%)
HnRNPA1 260..286 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.