DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and fne

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:256 Identity:90/256 - (35%)
Similarity:135/256 - (52%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 MCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPIN 144
            |.:...:..|.|.|          ||.|..||  .|.||||||||||.||..|:.:||.:||.:.
  Fly     1 MTNAMDIVKNGSAN----------GSVDGSND--ESRTNLIVNYLPQTMTQEEMRSLFSSIGELE 53

  Fly   145 TCRIMRD------------------YKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVS 191
            :|:::||                  .:.|.|.||.||::....|:::|:..|||:.::||.:|||
  Fly    54 SCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVS 118

  Fly   192 YARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREE 256
            ||||..||||..||||:.||:.::...|:.:|..:|.|:...||.|.::|..:||.|:|:::|.|
  Fly   119 YARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNE 183

  Fly   257 AQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPP-----PPQPPA 312
            |:.||..||...|:|.::|::|:.|.....:           ..|.:.||     .||..|
  Fly   184 AERAIQELNGKTPKGYAEPITVKFANNPSNS-----------AKAQIAPPLTAYLTPQAAA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 40/97 (41%)
RRM2_Hu_like 203..281 CDD:240822 29/77 (38%)
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.