DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and hnrnpaba

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_997752.2 Gene:hnrnpaba / 321466 ZFINID:ZDB-GENE-030131-185 Length:340 Species:Danio rerio


Alignment Length:273 Identity:62/273 - (22%)
Similarity:102/273 - (37%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGMDTEFSFPSSSSRRGYNDFPGCGG-SGGNG----GSANNLGGGNMCHLPPMASNNSLNNLCGL 98
            |..:.::...|.:...|.:|..|.|. ..|||    |:..|.|...                   
Zfish     2 SDAEQQYMETSLNGHEGEDDLNGAGQYDQGNGDAQAGAQGNAGADG------------------- 47

  Fly    99 SLGSGGSDDLMNDPRASNTN---LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGY 160
            :.|..|:|....|......:   :.|..|..|.:.::|...|...|.:..|.|..|..||.|.|:
Zfish    48 TAGDDGADGGQIDASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGF 112

  Fly   161 AFVDF--TSEMDSQRAIKV--LNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDT 221
            .|:.|  .|.:|...|.|.  |:|..:..|:.......|    :|  .::|..|....|::::..
Zfish   113 GFILFKEPSGVDKVLAQKEHRLDGRQIDPKKAMAMKKEP----VK--KIFVGGLNPETTEERIRE 171

  Fly   222 IFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI--------SALNNVIPEGG------ 272
            .||.:|.|....:..|..:.:.||..|:.: |.|||.:.|        |...:...:.|      
Zfish   172 YFGAFGEIETIELPMDPKSNKRRGFVFITF-KEEEAVKKILEKKYHNVSGTKDTSGKEGLCEIKI 235

  Fly   273 SQPLSVRLAEEHG 285
            :||..|...:::|
Zfish   236 AQPKEVYQQQQYG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 23/86 (27%)
RRM2_Hu_like 203..281 CDD:240822 21/91 (23%)
hnrnpabaNP_997752.2 CBFNT 1..69 CDD:285369 16/85 (19%)
RRM1_hnRNPAB 70..144 CDD:241201 22/73 (30%)
RRM2_hnRNPAB 149..228 CDD:241028 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.