DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and HNRNPD

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_112738.1 Gene:HNRNPD / 3184 HGNCID:5036 Length:355 Species:Homo sapiens


Alignment Length:218 Identity:56/218 - (25%)
Similarity:87/218 - (39%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GCGG---SGG-NGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNT---- 117
            |.||   ||| .||||.:.|.      ...||.|..:        .|.|:   :.||.|..    
Human    46 GTGGGTASGGTEGGSAESEGA------KIDASKNEED--------EGHSN---SSPRHSEAATAQ 93

  Fly   118 ----NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKV- 177
                .:.:..|..|.|.::|...|...|.:..|.:..|..||.|.|:.||.|   .:|:...|| 
Human    94 REEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLF---KESESVDKVM 155

  Fly   178 ------LNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILR 236
                  |||..:..||.|....:   |.:|  .::|..|.....::::...||.:|.:....:..
Human   156 DQKEHKLNGKVIDPKRAKAMKTK---EPVK--KIFVGGLSPDTPEEKIREYFGGFGEVESIELPM 215

  Fly   237 DKLTGRPRGVAFVRYNKREEAQE 259
            |..|.:.||..|:.:.:.|..::
Human   216 DNKTNKRRGFCFITFKEEEPVKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 24/94 (26%)
RRM2_Hu_like 203..281 CDD:240822 11/57 (19%)
HNRNPDNP_112738.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 19/62 (31%)
CBFNT <60..78 CDD:311868 6/31 (19%)
RRM1_hnRNPD 99..172 CDD:410150 22/75 (29%)
RRM2_hnRNPD 183..257 CDD:241027 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.