DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and HNRNPAB

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:251 Identity:52/251 - (20%)
Similarity:96/251 - (38%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSSSRRGYNDFP-GCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDP 112
            :.::..|:...| |...:|...|:|...||....  ||..:.|            |...|.:|..
Human    13 TGATENGHEAVPEGESPAGAGTGAAAGAGGATAA--PPSGNQN------------GAEGDQINAS 63

  Fly   113 RASNT--NLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAI 175
            :....  .:.|..|..|.:.::|...|...|.:..|.|..|..||.|.|:.|:.|......::.:
Human    64 KNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVL 128

  Fly   176 KV----LNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILR 236
            ..    |:|..:..|:.......|    :|  .::|..|....|::::...||::|.|....:..
Human   129 DQKEHRLDGRVIDPKKAMAMKKDP----VK--KIFVGGLNPEATEEKIREYFGEFGEIEAIELPM 187

  Fly   237 DKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGS-------QPLSVRLAEEHG 285
            |....:.||..|:.:.:.|..::.:....:.:  .||       ||..|...:::|
Human   188 DPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV--SGSKCEIKVAQPKEVYQQQQYG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 19/85 (22%)
RRM2_Hu_like 203..281 CDD:240822 17/84 (20%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868 14/70 (20%)
RRM1_hnRNPAB 66..145 CDD:410151 18/78 (23%)
RRM2_hnRNPAB 150..229 CDD:409997 16/86 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.