DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and HNRNPA2B1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens


Alignment Length:150 Identity:39/150 - (26%)
Similarity:70/150 - (46%) Gaps:9/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTS--EMDSQRAIK--VLN 179
            |.:..|..:.|:..|...:...|.:..|.:|||..:..|.|:.||.|:|  |:|:..|.:  .::
Human    23 LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSID 87

  Fly   180 GITVRNKR--LKVSYARPGGE-SIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTG 241
            |..|..||  .:....:||.. ::|  .|:|..:.....:..|...|.:||.|....|:.|:.:|
Human    88 GRVVEPKRAVAR
EESGKPGAHVTVK--KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSG 150

  Fly   242 RPRGVAFVRYNKREEAQEAI 261
            :.||..||.::..:...:.:
Human   151 KKRGFGFVTFDDHDPVDKIV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 23/83 (28%)
RRM2_Hu_like 203..281 CDD:240822 14/58 (24%)
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155 22/75 (29%)
RRM2_hnRNPA2B1 112..191 CDD:409995 15/60 (25%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353
HnRNPA1 302..326 CDD:402981
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.