DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and HNRNPA1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_112420.1 Gene:HNRNPA1 / 3178 HGNCID:5031 Length:372 Species:Homo sapiens


Alignment Length:519 Identity:101/519 - (19%)
Similarity:158/519 - (30%) Gaps:196/519 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTS--EMD---SQRAIKVL 178
            |.:..|..:.||..|.:.|...|.:..|.:|||..|..|.|:.||.:.:  |:|   :.|..|| 
Human    16 LFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV- 79

  Fly   179 NGITVRNKRL--KVSYARPGGE-SIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLT 240
            :|..|..||.  :....|||.. ::|  .::|..:.....:..|...|.:||.|....|:.|:.:
Human    80 DGRVVEPKRAVSRED
SQRPGAHLTVK--KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGS 142

  Fly   241 GRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPP 305
            |:.||.|||.:                              ::|                     
Human   143 GKKRGFAFVTF------------------------------DDH--------------------- 156

  Fly   306 PPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYLXLTP 370
                                                         |.:|.:..:|||      |.
Human   157 ---------------------------------------------DSVDKIVIQKYH------TV 170

  Fly   371 Q----QQQQLLQHQQQALGFTSSSNNSIGNGN----------GNDNNMLLYHQQYHQQQTQQQRL 421
            .    :.::.|..|:.| ..:||.....|:||          ||||               ..|.
Human   171 NGHNCEVRKALSKQEMA-SASSSQRGRSGSGNFGGGRGGGFGGNDN---------------FGRG 219

  Fly   422 GNVAAHNISPNGSNNNINTSNTNNINFNTIRQNGVAALHYLQEQLQLQQPQDQQSQQQQPLTMPS 486
            ||.:... ...||........:.: .:|....:|...                          ..
Human   220 GNFSGRG-GFGGSRGGGGYGGSGD-GYNGFGNDGGYG--------------------------GG 256

  Fly   487 SPPFQQQSRQSHHNGSSSTLGNQLLAISNNNSFNNNSNQSNSFTGNYSNGSAFTSNGAISGSNFP 551
            .|.:...||.....|..  .|||......:.|:::.:|         ..|..|   |..|||||.
Human   257 GPGYSGGSRGYGSGGQG--YGNQGSGYGGSGSYDSYNN---------GGGGGF---GGGSGSNFG 307

  Fly   552 NNPTSS--GNFTNNSTNSNPTNSGHFASNLAGSSNFTNHLSGSNNY---TNSNGNFTSNAASSS 610
            ...:.:  ||:.|.|:|..|...|:|....:|.      ..|...|   ..:.|.:..:::|||
Human   308 GGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGP------YGGGGQYFAKPRNQGGYGGSSSSSS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 27/84 (32%)
RRM2_Hu_like 203..281 CDD:240822 14/77 (18%)
HNRNPA1NP_112420.1 Globular A domain 4..94 25/78 (32%)
RRM1_hnRNPA1 12..92 CDD:410154 25/76 (33%)
Globular B domain 95..185 26/193 (13%)
RRM2_hnRNPA3 105..184 CDD:409996 23/182 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..216 11/49 (22%)
RNA-binding RGG-box 218..240 5/22 (23%)
HnRNPA1 307..344 CDD:402981 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..372 14/55 (25%)
Nuclear targeting sequence (M9) 320..357 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.