DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and elavl3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_009298008.1 Gene:elavl3 / 30732 ZFINID:ZDB-GENE-980526-76 Length:366 Species:Danio rerio


Alignment Length:280 Identity:101/280 - (36%)
Similarity:149/280 - (53%) Gaps:43/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRE 132
            ||.|..:|..|      |:.|.|            |.:||       |.||||||||||:||..|
Zfish    14 NGPSGTSLPNG------PVISTN------------GATDD-------SKTNLIVNYLPQNMTQEE 53

  Fly   133 LYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGG 197
            ..:||.:||.|.:|:::||..||.|.||.||::....|:.:||..|||:.::.|.:|||||||..
Zfish    54 FKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDADKAINTLNGLKLQTKTIKVSYARPSS 118

  Fly   198 ESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLT-GRPRGVAFVRYNKREEAQEAI 261
            .||:|.||||:.||:|::...::.:|.:||.|:...||.|::| |..|||.|:|::||.||:|||
Zfish   119 ASIRDANLYVSGLPKTMSQKDMEQLFSQYGRIITSRILVDQVTAGISRGVGFIRFDKRNEAEEAI 183

  Fly   262 SALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGA 326
            ..||...|.|.::|::|:.|....:......::|:....|.....|..   |....|.:      
Zfish   184 KGLNGQKPLGAAEPITVKFANNPSQKTGQALLTQLYQTAARRYTGPLH---HQTQRFRL------ 239

  Fly   327 MEKLRSLFDAICDAIFGLDS 346
                    |.:.:|.:|:.|
Zfish   240 --------DNLLNASYGVKS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 42/79 (53%)
RRM2_Hu_like 203..281 CDD:240822 34/78 (44%)
elavl3XP_009298008.1 ELAV_HUD_SF 35..365 CDD:273741 91/241 (38%)
RRM1_Hu 37..114 CDD:241094 38/76 (50%)
RRM_SF 119..209 CDD:302621 38/89 (43%)
RRM3_HuC 282..366 CDD:241099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.