DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and elavl1b

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_570984.2 Gene:elavl1b / 30065 ZFINID:ZDB-GENE-000210-17 Length:360 Species:Danio rerio


Alignment Length:255 Identity:93/255 - (36%)
Similarity:151/255 - (59%) Gaps:16/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFT 166
            :|..|.:.::|..:.||||:|||||:|:..||.:||.:||.:.:.:::||...|:|.||.||::.
Zfish    41 NGYEDPMGDEPSDAKTNLIINYLPQNMSQEELRSLFSSIGEVESAKLIRDKMAGHSLGYGFVNYV 105

  Fly   167 SEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQ 231
            :..|::|||..|||:.:::|.:|||||||..:.|||.|||::.||:|:|...::.:|.:||.|:.
Zfish   106 NPSDAERAINTLNGLRLQSKTIKVSYARPSSDGIKDANLYISGLPKTMTQKNVEDMFTQYGRIIN 170

  Fly   232 KNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQM 296
            ..||.|:.:|..|||||:|::||.||:|||..||...|.|.|:|::|:.|....::|.:..:||:
Zfish   171 SRILVDQASGLSRGVAFIRFDKRSEAEEAIKDLNGSKPSGASEPITVKFAANPNQSKNSQLLSQL 235

  Fly   297 ---------GVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSE 347
                     |       |...||.....:..::.|...:|....|.....|..::.|..:
Zfish   236 YHTQSRRFGG-------PVHHQPQRFRFSPMSVDHSVSSMNVASSSSSGWCIFVYNLGQD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 39/79 (49%)
RRM2_Hu_like 203..281 CDD:240822 35/77 (45%)
elavl1bNP_570984.2 ELAV_HUD_SF 53..360 CDD:273741 90/243 (37%)
RRM1_Hu 55..132 CDD:241094 35/76 (46%)
RRM_SF 142..225 CDD:302621 36/82 (44%)
RRM_SF 277..360 CDD:302621 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.