DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and TRA2A

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:83 Identity:30/83 - (36%)
Similarity:48/83 - (57%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAI 175
            ||   ||.|.|..|....|:|:|..:|...||::...::.|.:||.|.|:|||.|....||:.|:
Human   116 DP---NTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAM 177

  Fly   176 KVLNGITVRNKRLKVSYA 193
            :..||:.:..:|::|.|:
Human   178 ERANGMELDGRRIRVDYS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 27/77 (35%)
RRM2_Hu_like 203..281 CDD:240822
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 2/4 (50%)
RRM_TRA2 118..197 CDD:409798 28/78 (36%)
Linker 198..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.