DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Pabpc4l

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001099899.1 Gene:Pabpc4l / 295010 RGDID:1559517 Length:370 Species:Rattus norvegicus


Alignment Length:194 Identity:50/194 - (25%)
Similarity:92/194 - (47%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 MNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQR 173
            :.:..|..||:.:.....||.|..|.::|...|...:.::|:| .:|.|..:.||.|.|...::.
  Rat   182 LREKPAEFTNVYIKNFGDDMDDESLRSVFSKYGQTLSVKVMKD-ASGKSKRFGFVSFDSHKAAKN 245

  Fly   174 AIKVLNGITV---------------RNKRLKVSYARPGGESIK---DTNLYVTNLPRTITDDQLD 220
            |::.:||..:               |...||..:.:...|.|:   ...||:.||..||.|:.|.
  Rat   246 AVEDMNGRDINGQTIFVGRAQKKVERQAELKEMFEQMKKERIRARQAAKLYIKNLDDTIDDETLR 310

  Fly   221 TIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEH 284
            ..|..:|||.:..::::  .|:.:|...:.:...|.|.:|::.:|..|.  ||:||::.|.::|
  Rat   311 KEFSVFGSICRVKVMQE--AGQSKGFGLICFFSPEAAAKAMAEMNGRIL--GSKPLNIALGQKH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/94 (23%)
RRM2_Hu_like 203..281 CDD:240822 23/77 (30%)
Pabpc4lNP_001099899.1 ELAV_HUD_SF 11..262 CDD:273741 20/80 (25%)
RRM1_I_PABPs 11..89 CDD:240824
RRM2_I_PABPs 96..171 CDD:240825
RRM3_I_PABPs 189..268 CDD:240826 19/79 (24%)
RRM_SF 293..369 CDD:302621 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.