DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Rbms2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_006240804.1 Gene:Rbms2 / 288771 RGDID:1304813 Length:405 Species:Rattus norvegicus


Alignment Length:513 Identity:118/513 - (23%)
Similarity:180/513 - (35%) Gaps:145/513 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPR 113
            |.:||.|.:.|      |.|..:........|.  ||...|.:.|:    |.||||:|.|     
  Rat     4 SVTSRPGISTF------GYNKNNKKLYVAQQMA--PPSPRNGTPNS----SSGSGGNDQL----- 51

  Fly   114 ASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVL 178
             |.|||.:..|....||::|..|.:..|.|.:.:.:.|..|....||.||||.|...:|:|:..|
  Rat    52 -SKTNLYIRGLQPSTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTAL 115

  Fly   179 NGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRP 243
            ....|:.:..|.....|       ||||::|||.::.:.:|:.:...:|.::...|||| .||..
  Rat   116 KASGVQAQMAKQQEQDP-------TNLYISNLPLSMDEQELEGMLKPFGQVISTRILRD-TTGAS 172

  Fly   244 RGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPP 308
            |||.|.|....|:.:..|:                            ||..:....|..|..|..
  Rat   173 RGVGFARMESTEKCEAIIT----------------------------HFNGKYIKTPPGVAAPSD 209

  Fly   309 QPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYLXLTPQQQ 373
                                      ..:|         .|||  .|..:|           |.|
  Rat   210 --------------------------PLLC---------KFAD--GGPKKR-----------QNQ 226

  Fly   374 QQLLQHQQQALGFTSSSNNSIGNGNGNDNNMLLYHQQYHQQQTQQQRLGNVAAHNISPNGSNNNI 438
            .:.:|            |......||:...|.|.:......|                    |..
  Rat   227 GKFVQ------------NGRAWPRNGDMGGMALTYDPTTALQ--------------------NGF 259

  Fly   439 NTSNTNNINFNTIRQNGVAALHYLQEQLQLQQPQDQQSQQQQPLTMPSSPPFQQQSRQSHHNGSS 503
            .|:..:..:...:.|:.:|.  ||...:...|...|.|    |:.:|::...||||.....:||.
  Rat   260 YTAPYSLAHSRMLAQSALAP--YLPSPVSSYQRVTQTS----PVQVPNTSWMQQQSYLMQPSGSV 318

  Fly   504 STLG-NQLLAISNNNSFNNNSNQSNSFTGNYSNGSAFTSNGAISG---SNFPNNPTSS 557
            .|.| :..|::...:.....:.|....:.| |.|:...:..|:.|   |.:|..|:||
  Rat   319 LTPGMDHPLSLQPASMMGPLTQQLGHLSLN-SLGTFMPAAAAMQGTYISQYPAVPSSS 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 25/79 (32%)
RRM2_Hu_like 203..281 CDD:240822 22/77 (29%)
Rbms2XP_006240804.1 RRM_SF 47..132 CDD:302621 28/90 (31%)
RRM2_MSSP2 133..218 CDD:240918 31/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.