DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Elavl3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_758827.1 Gene:Elavl3 / 282824 RGDID:628892 Length:367 Species:Rattus norvegicus


Alignment Length:229 Identity:96/229 - (41%)
Similarity:140/229 - (61%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GGSANNLGGGNMCHLP--PMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDR 131
            |...:.:|||     |  |...|..|       ||:.|:.|      .|.||||||||||:||..
  Rat     7 GAMESQVGGG-----PAGPALPNGPL-------LGTNGATD------DSKTNLIVNYLPQNMTQD 53

  Fly   132 ELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPG 196
            |..:||.:||.|.:|:::||..||.|.||.||:::...|:.:||..|||:.::.|.:|||||||.
  Rat    54 EFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPS 118

  Fly   197 GESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAI 261
            ..||:|.||||:.||:|::..:::.:|.:||.|:...||.|:.||..|||.|:|::||.||:|||
  Rat   119 SASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAI 183

  Fly   262 SALNNVIPEGGSQPLSVRLA----EEHGKAKAAH 291
            ..||...|.|.::|::|:.|    ::.|:|...|
  Rat   184 KGLNGQKPLGAAEPITVKFANNPSQKTGQALLTH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 42/79 (53%)
RRM2_Hu_like 203..281 CDD:240822 34/77 (44%)
Elavl3NP_758827.1 ELAV_HUD_SF 36..366 CDD:273741 84/182 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.