DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Larp7

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_613059.2 Gene:Larp7 / 28036 MGIID:107634 Length:570 Species:Mus musculus


Alignment Length:189 Identity:56/189 - (29%)
Similarity:77/189 - (40%) Gaps:58/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RAIKV-------LNGITVRNKRLKVSYARPGGESIKD---TNLYVTNLPRTITDDQLDTIFGKYG 227
            ||:|.       |.|..:|.|       :|.||..||   ..:||..||:.:|...::.:|||.|
Mouse    86 RALKSSSVVELDLEGTRIRR
K-------KPLGERPKDEEERTVYVELLPKNVTHSWIERVFGKCG 143

  Fly   228 SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQP------------LSVRL 280
            ::|..:|...|.||.|:|.|||.:..:|:|.:||..|||...|...:|            .|:|:
Mouse   144 NVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPSLRV 208

  Fly   281 AEEHGKAK----------------AAHFMSQMGVV-------------PANVPPPPPQP 310
            |||..|.|                :|...|..||.             .|..|..|.||
Mouse   209 AEEKKKKKKKKGRIKKEESVQAKESAVDSSSSGVCKATKRPRTASEGSEAETPEAPKQP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 8/30 (27%)
RRM2_Hu_like 203..281 CDD:240822 30/89 (34%)
Larp7NP_613059.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LARP_7 25..105 CDD:153401 5/18 (28%)
RRM1_LARP7 120..199 CDD:240736 28/78 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..364 21/88 (24%)
RRM_3 442..540 CDD:285930
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.