DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and tif35

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_595727.1 Gene:tif35 / 2540819 PomBaseID:SPBC18H10.03 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:92 Identity:30/92 - (32%)
Similarity:46/92 - (50%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LKVSYARPGGESI------KDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGV 246
            |:....|..|:|:      ....|.||||.....:::|..:|.::|.|.:..:.:||.|||.:|.
pombe   181 LRAGSGRESGDSMFKRERDDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGF 245

  Fly   247 AFVRYNKREEAQEAISAL-----NNVI 268
            |||.|..|:.|.:|...|     ||:|
pombe   246 AFVSYYDRDCAIKARDRLDGYGWNNLI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 2/8 (25%)
RRM2_Hu_like 203..281 CDD:240822 26/71 (37%)
tif35NP_595727.1 eIF3g 26..148 CDD:289149
RRM <191..>282 CDD:223796 27/82 (33%)
RRM_eIF3G_like 203..279 CDD:240854 26/70 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.