DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and spo5

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_596047.1 Gene:spo5 / 2540637 PomBaseID:SPBC29A10.02 Length:567 Species:Schizosaccharomyces pombe


Alignment Length:297 Identity:70/297 - (23%)
Similarity:126/297 - (42%) Gaps:42/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMDTEFSFPSSSSRRGYNDFPGCGGSGGNG 69
            |.||.:..|  .|.|.....|:......:|.|:||....:.:.|::     .|.....|.:..|.
pombe   200 NQPGLHIVN--QPTYLAPVPSATVPTNSVSLSMPSFSQGQKNIPAA-----INQEMSVGTTKENT 257

  Fly    70 GSANNLGGGNMCHLP------PMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDM 128
            ...:.|.|.:....|      ||:.:|..:|:               :..:...|:.:..||.:.
pombe   258 NYLSQLVGLHPAIPPAIPSMFPMSHDNKKSNM---------------ESTSRTRNVYIRGLPPNT 307

  Fly   129 TDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYA 193
            :|..|.......|.:::.:.:.|.:|....||.|..|..|   :.|:..::.:|:..  .:.|:|
pombe   308 SDENLLLYTNRFGKVSSSKAIIDMETNLCKGYGFACFEEE---KSALICISAMTLCG--YQCSFA 367

  Fly   194 RPGG----ESIKD---TNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRY 251
            :...    :|::|   ||||::|||....:..:.|:| |...|:...:|||. ..:.|||.|.|.
pombe   368 KESFSARLQSLQDTESTNLYISNLPLHWNESDISTLF-KPSKIISNRVLRDS-KEQSRGVGFARM 430

  Fly   252 NKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAK 288
            ..|:.|::.|:..||.:.:....||.:|.|:...:.|
pombe   431 QDRKTAEDIINKFNNFVLDPALPPLQIRFADSTDQKK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 17/79 (22%)
RRM2_Hu_like 203..281 CDD:240822 27/77 (35%)
spo5NP_596047.1 RRM1_MSSP 296..366 CDD:240689 15/74 (20%)
RRM2_MSSP 384..461 CDD:240690 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.