DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and HNRNPA3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001317178.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens


Alignment Length:497 Identity:96/497 - (19%)
Similarity:149/497 - (29%) Gaps:160/497 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NDPRASN--TNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFT--SEMD 170
            :||:...  ..|.:..|..:.||..|...|...|.:..|.:|||.:|..|.|:.||.::  .|:|
Human    26 HDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVD 90

  Fly   171 S---QRAIKVLNGITVRNKRL--KVSYARPGGE-SIKDTNLYVTNLPRTITDDQLDTIFGKYGSI 229
            :   .|..|| :|..|..||.  :....:||.. ::|  .::|..:.....:..|...|.|||.|
Human    91 AAMCARPHKV-DGRVVEPKRAVSREDSVKPGAHLTVK--KIFVGGIKEDTEEYNLRDYFEKYGKI 152

  Fly   230 VQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMS 294
            ....::.|:.:|:.||.|||.::..:...:.:....:.| .|.:..:...|:::..::..    |
Human   153 ETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTI-NGHNCEVKKALSKQEMQSAG----S 212

  Fly   295 QMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRR 359
            |.|               ....:.|.|.|.|.               ||....||.  ..|.:..
Human   213 QRG---------------RGGGSGNFMGRGGN---------------FGGGGGNFG--RGGNFGG 245

  Fly   360 KYHYPYLXLTPQQQQQLLQHQQQALGFTSSSNNSIGNGNGNDNNMLLYHQQYHQQQTQQQRLGNV 424
            :..|.                    |....|..|.|.|:|..|..                    
Human   246 RGGYG--------------------GGGGGSRGSYGGGDGGYNGF-------------------- 270

  Fly   425 AAHNISPNGSNNNINTSNTNNINFNTIRQNGVAALHYLQEQLQLQQPQDQQSQQQQPLTMPSSPP 489
                   .|...|..                                              ..|.
Human   271 -------GGDGGNYG----------------------------------------------GGPG 282

  Fly   490 FQQQSRQSHHNGSSSTLGNQLLAISNNNSFNNNSNQSNSFTGNYSNGSAFTSNGAISGSNFPN-N 553
            :   |.:..:.|.....|||.........::..:...|...|||..|..:...|..||....| .
Human   283 Y---SSRGGYGGGGPGYGNQGGGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYG 344

  Fly   554 PTSSGNFTNNSTNSNPTNSGHFASNLAGSSNFTNHLSGSNNY 595
            |...|:|...|:.| |...|:      ||.      .||..|
Human   345 PMKGGSFGGRSSGS-PYGGGY------GSG------GGSGGY 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/86 (30%)
RRM2_Hu_like 203..281 CDD:240822 16/77 (21%)
HNRNPA3NP_001317178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 2/8 (25%)
RRM1_hnRNPA_like 36..113 CDD:409992 25/77 (32%)
RRM2_hnRNPA3 126..205 CDD:409996 18/81 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 4/39 (10%)
HnRNPA1 331..>347 CDD:402981 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.