DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and ELAVL3

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_024307178.1 Gene:ELAVL3 / 1995 HGNCID:3314 Length:424 Species:Homo sapiens


Alignment Length:286 Identity:96/286 - (33%)
Similarity:142/286 - (49%) Gaps:81/286 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GGSANNLGGGNMCHLP--PMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDR 131
            |...:.:|||     |  |...|..|       ||:.|:.|      .|.||||||||||:||..
Human     7 GAMESQVGGG-----PAGPALPNGPL-------LGTNGATD------DSKTNLIVNYLPQNMTQD 53

  Fly   132 ELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPG 196
            |..:||.:||.|.:|:::||..||.|.||.||:::...|:.:||..|||:.::.|.:|||||||.
Human    54 EFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPS 118

  Fly   197 GESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGR------------------- 242
            ..||:|.||||:.||:|::..:::.:|.:||.|:...||.|::||:                   
Human   119 SASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGQAVREGAPGGGAGQRQSGGT 183

  Fly   243 --------------------------------------PRGVAFVRYNKREEAQEAISALNNVIP 269
                                                  .|||.|:|::||.||:|||..||...|
Human   184 NVGKPTKMPGHEAGKGEVGLHRRGQGRRDGHPCPLAGVSRGVGFIRFDKRIEAEEAIKGLNGQKP 248

  Fly   270 EGGSQPLSVRLA----EEHGKAKAAH 291
            .|.::|::|:.|    ::.|:|...|
Human   249 LGAAEPITVKFANNPSQKTGQALLTH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 42/79 (53%)
RRM2_Hu_like 203..281 CDD:240822 34/134 (25%)
ELAVL3XP_024307178.1 RRM 36..423 CDD:330708 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.