Sequence 1: | NP_001259303.1 | Gene: | Sxl / 3772180 | FlyBaseID: | FBgn0264270 | Length: | 722 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001410.2 | Gene: | ELAVL1 / 1994 | HGNCID: | 3312 | Length: | 326 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 89/204 - (43%) |
---|---|---|---|
Similarity: | 135/204 - (66%) | Gaps: | 2/204 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 LGSGGSDDLMNDPRA--SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAF 162
Fly 163 VDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYG 227
Fly 228 SIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHF 292
Fly 293 MSQMGVVPA 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sxl | NP_001259303.1 | RRM1_SXL | 117..197 | CDD:241093 | 41/79 (52%) |
RRM2_Hu_like | 203..281 | CDD:240822 | 34/77 (44%) | ||
ELAVL1 | NP_001410.2 | ELAV_HUD_SF | 19..326 | CDD:273741 | 85/186 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000313 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |