DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and ELAVL2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_011516080.2 Gene:ELAVL2 / 1993 HGNCID:3313 Length:392 Species:Homo sapiens


Alignment Length:289 Identity:108/289 - (37%)
Similarity:160/289 - (55%) Gaps:34/289 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRE 132
            ||.:.||...|          ..::||.|...:.||.::|       |.||||||||||:||..|
Human    39 NGPTCNNTANG----------PTTINNNCSSPVDSGNTED-------SKTNLIVNYLPQNMTQEE 86

  Fly   133 LYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGG 197
            |.:||.:||.|.:|:::||..||.|.||.||::....|:::||..|||:.::.|.:|||||||..
Human    87 LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSS 151

  Fly   198 ESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAIS 262
            .||:|.||||:.||:|:|..:|:.:|.:||.|:...||.|::||..|||.|:|::||.||:|||.
Human   152 ASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIK 216

  Fly   263 ALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRDGAM 327
            .||...|.|.::|::|:.|....:......:||:...|..   ..|.|.|..|..|.:       
Human   217 GLNGQKPPGATEPITVKFANNPSQKTNQAILSQLYQSPNR---RYPGPLAQQAQRFRL------- 271

  Fly   328 EKLRSLFDAICDAIFGLDSENFADLLDGL 356
                   |.:.:..:|:.|......:||:
Human   272 -------DNLLNMAYGVKSRFSPMTIDGM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 43/79 (54%)
RRM2_Hu_like 203..281 CDD:240822 36/77 (47%)
ELAVL2XP_011516080.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.