DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and sf3b4

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_705947.3 Gene:sf3b4 / 192318 ZFINID:ZDB-GENE-020419-22 Length:400 Species:Danio rerio


Alignment Length:225 Identity:65/225 - (28%)
Similarity:107/225 - (47%) Gaps:26/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 RASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKV 177
            |..:..:.|..|.:.:::..|:.||...||:....:.:|..||...||.||:|.||.|:..|||:
Zfish     9 RNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKI 73

  Fly   178 LNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRTITDDQLDTIFGKYGSIVQ-KNILRDKLT 240
            :|.|.:..|.::|:.|....:::. ..|:::.||...|.:..|...|..:|.|:| ..|:||..|
Zfish    74 MNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDT 138

  Fly   241 GRPRGVAFVRYNKREEAQEAISALNNVIPEGG----SQPLSVRLA-------EEHGKAKAAHFMS 294
            |..:|.||:.:...:.:..||.|:|      |    ::|::|..|       |.||.|......:
Zfish   139 GNSKGYAFINFASFDASDAAIEAMN------GQYLCNRPITVSYAFKKDSKGERHGSAAERLLAA 197

  Fly   295 QMGVVPANVP-------PPPPQPPAHMAAA 317
            |..:..|:.|       ||||..|..:..|
Zfish   198 QNPLSQADRPHQLFADAPPPPSMPTPVMTA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 26/79 (33%)
RRM2_Hu_like 203..281 CDD:240822 24/82 (29%)
sf3b4NP_705947.3 RRM1_SF3B4 15..88 CDD:240780 25/72 (35%)
RRM2_SF3B4 99..181 CDD:240781 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.