DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and Ptbp1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_001070831.1 Gene:Ptbp1 / 19205 MGIID:97791 Length:555 Species:Mus musculus


Alignment Length:310 Identity:66/310 - (21%)
Similarity:115/310 - (37%) Gaps:102/310 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YNNKSSGGRGFGMSHSLPSG---------MDTEFSFPSSSSRRGYNDFPGCGGSG---------G 67
            |||..|  |.: ....||||         |...|..|...|...|      .|:|         .
Mouse   266 YNNDKS--RDY-TRPDLPSGDSQPSLDQTMAAAFGAPGIMSASPY------AGAGFPPTFAIPQA 321

  Fly    68 NGGSANNLGGGNMCHLPPM----------ASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVN 122
            .|.|..|:.|.    |.|:          ||..::..|.|                |.|:.|:|:
Mouse   322 AGLSVPNVHGA----LAPLAIPSAAAAAAASRIAIPGLAG----------------AGNSVLLVS 366

  Fly   123 YL-PQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNK 186
            .| |:.:|.:.|:.||...|.:...:|:.:.|..     |.|.......:|.|:..|||..:..|
Mouse   367 NLNPERVTPQSLFILFGVYGDVQRVKILFNKKEN-----ALVQMADGSQAQLAMSHLNGHKLHGK 426

  Fly   187 RLKVS------------------------------YARPGGESIKD-----TNLYVTNLPRTITD 216
            .::::                              :.:||.::.::     ..|:::|:|.::::
Mouse   427 SVRITLSKHQSVQLPREGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSE 491

  Fly   217 DQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNN 266
            |.|.::|...|.:|:    ..|...:.|.:|.::....|||.:|:..|:|
Mouse   492 DDLKSLFSSNGGVVK----GFKFFQKDRKMALIQMGSVEEAVQALIELHN 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 20/110 (18%)
RRM2_Hu_like 203..281 CDD:240822 17/64 (27%)
Ptbp1NP_001070831.1 hnRNP-L_PTB 56..555 CDD:273733 66/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.