DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and rbmx-2

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_495237.1 Gene:rbmx-2 / 183040 WormBaseID:WBGene00016245 Length:302 Species:Caenorhabditis elegans


Alignment Length:102 Identity:26/102 - (25%)
Similarity:53/102 - (51%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LNGIT-VRN------KRLKVSYA----RPGGESIKDTN-LYVTNLPRTITDDQLDTIFGKYGSIV 230
            :|.|| ::|      :.|.:.||    :...::.||:. :|:..|...:::..:..:|.:||.::
 Worm     1 MNPITNIKNQNRMNERELSLGYAGDLKKSWHQTYKDSAWIYIGGLSYALSEGDVIAVFSQYGEVM 65

  Fly   231 QKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNV 267
            ..|::|||.||:.:|.||:.|..:.....|:...|.:
 Worm    66 NINLIRDKDTGKSKGFAFLCYKDQRSTILAVDNFNGI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 7/29 (24%)
RRM2_Hu_like 203..281 CDD:240822 17/66 (26%)
rbmx-2NP_495237.1 RRM_ist3_like 29..117 CDD:240857 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.