DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and rbm-34

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_502291.1 Gene:rbm-34 / 178148 WormBaseID:WBGene00008688 Length:394 Species:Caenorhabditis elegans


Alignment Length:217 Identity:52/217 - (23%)
Similarity:94/217 - (43%) Gaps:46/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NDPRASNT----NLIVNYLPQDMTDRELYALFRAIGPINTCRI--------------------MR 150
            ::.|||..    .:.|..:|..|.::.:..:|...|.|::.|:                    :.
 Worm   132 SNARASAAENALTVFVGNMPLTMNEKSVRRIFSDFGTISSVRMRNLLPANEKLTKRVTHLTGKLN 196

  Fly   151 DYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGG---ESIKDTNLYVTNLPR 212
            |.::..:|   :|.|.:|...::|:| .||..:.:..::|.  :.|.   |..||..::|.|||.
 Worm   197 DKQSSLTF---YVKFGAEESVEKALK-YNGTKLDDHVIRVD--KVGSKKKEFGKDMAIFVGNLPF 255

  Fly   213 TITDDQLDTIF-GKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAIS-----------ALN 265
            .||:|.|.|.| .:.|.:....|:|||.||:.:|.|||.:.:......|:|           .:.
 Worm   256 EITEDALITFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNFKQDSSVSLALSMETIKMEKRDLRIT 320

  Fly   266 NVIPEGGSQPL-SVRLAEEHGK 286
            .|:.:|....: :.:....|||
 Worm   321 KVMKKGHLTKIQTAKKRTSHGK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 17/103 (17%)
RRM2_Hu_like 203..281 CDD:240822 25/90 (28%)
rbm-34NP_502291.1 RRM1_RBM34 144..233 CDD:240840 16/92 (17%)
RRM2_RBM34 247..320 CDD:240841 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.