DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and grld-1

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_741283.1 Gene:grld-1 / 176827 WormBaseID:WBGene00017929 Length:520 Species:Caenorhabditis elegans


Alignment Length:219 Identity:57/219 - (26%)
Similarity:88/219 - (40%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NDPRASNTNLIVNYLPQDMTDRELYALFRAIG---------PINTCRIMRDYKTGYSFGYAFVDF 165
            :|..|:.| |.|..:|.|:.:||:..:|...|         ||||           ...||||.|
 Worm   163 DDDEATRT-LFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINT-----------DAAYAFVMF 215

  Fly   166 --TSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGS 228
              ..:....:|.:....|.....|:|:.|    |:|.....|:|..|......:.|...||::|.
 Worm   216 QTVDQAIQAKAEEQDRPIRAGGSRMKIGY----GKSQVSRRLFVGGLGSWCDKEILQKAFGEFGF 276

  Fly   229 IVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEE-HGKAKAAHF 292
            :  :||..|.  |:|  .|:|.|.....:|||..:|.......|:.|:.|..|:: ..:.:...|
 Worm   277 V--ENIDYDH--GQP--YAYVVYENTHTSQEACRSLRGACISKGNHPIMVDYAKDLTAQPEKQQF 335

  Fly   293 M-------SQMGVVPANVPPPPPQ 309
            |       |.:|......||..|:
 Worm   336 MRKRRASKSPVGASAVRTPPGSPK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 23/90 (26%)
RRM2_Hu_like 203..281 CDD:240822 22/77 (29%)
grld-1NP_741283.1 RRM_SF 33..>93 CDD:302621
RRM_SF 167..246 CDD:302621 24/94 (26%)
RRM3_Spen 253..324 CDD:240756 22/76 (29%)
SPOC 376..482 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.