Sequence 1: | NP_001259303.1 | Gene: | Sxl / 3772180 | FlyBaseID: | FBgn0264270 | Length: | 722 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741283.1 | Gene: | grld-1 / 176827 | WormBaseID: | WBGene00017929 | Length: | 520 | Species: | Caenorhabditis elegans |
Alignment Length: | 219 | Identity: | 57/219 - (26%) |
---|---|---|---|
Similarity: | 88/219 - (40%) | Gaps: | 41/219 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 NDPRASNTNLIVNYLPQDMTDRELYALFRAIG---------PINTCRIMRDYKTGYSFGYAFVDF 165
Fly 166 --TSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGS 228
Fly 229 IVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEE-HGKAKAAHF 292
Fly 293 M-------SQMGVVPANVPPPPPQ 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sxl | NP_001259303.1 | RRM1_SXL | 117..197 | CDD:241093 | 23/90 (26%) |
RRM2_Hu_like | 203..281 | CDD:240822 | 22/77 (29%) | ||
grld-1 | NP_741283.1 | RRM_SF | 33..>93 | CDD:302621 | |
RRM_SF | 167..246 | CDD:302621 | 24/94 (26%) | ||
RRM3_Spen | 253..324 | CDD:240756 | 22/76 (29%) | ||
SPOC | 376..482 | CDD:285043 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |