DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and rnp-6

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_491176.1 Gene:rnp-6 / 171922 WormBaseID:WBGene00004389 Length:749 Species:Caenorhabditis elegans


Alignment Length:241 Identity:57/241 - (23%)
Similarity:94/241 - (39%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 QDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKV 190
            :||..|    .|...|||.:..:..|..||:...:|||::.....:..|.:.:||..:..:.|||
 Worm   115 EDMLRR----AFDPFGPIKSINMSWDPATGHHKTFAFVEYEVPEAALLAQESMNGQMLGGRNLKV 175

  Fly   191 S--------------YARPGGESI-KDT----NLYVTNLPRTITDDQLDTIFGKYGSIVQKNILR 236
            :              .|:|..:.: ||.    .:||:::...:::..|.::|..:|.||:..:.|
 Worm   176 NSMMFQEMRLPQNMPQAQPIIDMVQKDAKKYFRVYVSSVHPDLSETDLKSVFEAFGEIVKCQLAR 240

  Fly   237 DKLTGR-PRGVAFVRYNKREEAQEAISALNNVIPEGGS-----------------QPLSVR---- 279
            .. ||| .||..::.:|......|||:.: |:...||.                 ||.||.    
 Worm   241 AP-TGRGHRGFGYLEFNNLTSQSEAIAGM-NMFDLGGQYLRVGKCVTPPDALTYLQPASVSAIPA 303

  Fly   280 -------------LAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPA 312
                         :|.|.....:....|:.|...|..|.|..|.||
 Worm   304 SVSVACAAITAKVMAAEAAAGSSPKTPSESGGSRAASPAPRAQSPA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 21/84 (25%)
RRM2_Hu_like 203..281 CDD:240822 24/116 (21%)
rnp-6NP_491176.1 half-pint 5..749 CDD:130706 57/241 (24%)
RRM1_PUF60 102..177 CDD:240816 19/65 (29%)
RRM2_PUF60 207..283 CDD:240817 20/77 (26%)
RRM_SF 657..748 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.