DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and SRSF12

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:NP_542781.3 Gene:SRSF12 / 135295 HGNCID:21220 Length:261 Species:Homo sapiens


Alignment Length:417 Identity:78/417 - (18%)
Similarity:128/417 - (30%) Gaps:170/417 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 YARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREE 256
            |.||     .:|:|::.|:......:.|...||:||.||...|..|..|.||||.|:|::....:
Human     4 YTRP-----PNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRD 63

  Fly   257 AQEAISALNNVIPEGGSQPLSVRLAE------EHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMA 315
            |::|:..||.....|  :.:.::.|:      ...|:|..|               |..|..|  
Human    64 AEDALYNLNRKWVCG--RQIEIQFAQGDRKTPGQMKSKERH---------------PCSPSDH-- 109

  Fly   316 AAFNMMHRDGAMEKLRSLFDAICDAIFGLDSENFADLLDGLYRRKYHYPYLXLTPQQQQQLLQHQ 380
                                                      ||       ..:|.|::      
Human   110 ------------------------------------------RR-------SRSPSQRR------ 119

  Fly   381 QQALGFTSSSNNSIG-NGNGNDNNMLLYHQQ--YHQQQTQQQRLGNVAAHNISPNGSNNNINTSN 442
                  |.|.::|.| |...:|:.....|::  |.|.:::.:.|         |..| .:...|.
Human   120 ------TRSRSSSWGRNRRRSDSLKESRHRRFSYSQSKSRSKSL---------PRRS-TSARQSR 168

  Fly   443 TNNINFNTIRQNGVAALHYLQEQLQLQQPQDQQSQQQQPLTMPSSPPFQQQSRQSHHNGSSSTLG 507
            |...||.:                                        :.:||.......|.::|
Human   169 TPRRNFGS----------------------------------------RGRSRSKSLQKRSKSIG 193

  Fly   508 NQLLAISNNNSFNNNSNQSNSFTGNYSNGSAFTSNGAISGSNFPNNPTSSGNFTNNSTNSNPTNS 572
                           .:||:|.....|:|:...|:|..|.|...:...|...:||:.|.......
Human   194 ---------------KSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQTAKH 243

  Fly   573 GHFASNLAGSSNFTNHLSGSNNYTNSN 599
            .||.|:           |.|.:|.:.|
Human   244 SHFRSH-----------SRSRSYRHKN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 3/4 (75%)
RRM2_Hu_like 203..281 CDD:240822 24/77 (31%)
SRSF12NP_542781.3 RRM_SRSF10_SRSF12 10..93 CDD:240758 25/84 (30%)
PABP-1234 <12..211 CDD:130689 59/343 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..261 51/328 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.