DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AgaP_AGAP005505

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_315504.4 Gene:AgaP_AGAP005505 / 1276189 VectorBaseID:AGAP005505 Length:511 Species:Anopheles gambiae


Alignment Length:220 Identity:50/220 - (22%)
Similarity:85/220 - (38%) Gaps:60/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 QDMTDRELYALFRAIGPINTCRIMRDYKTGYSFG---------------YAFVDFTSEMDSQRAI 175
            :.:|:..|...|...|.|....|::|..||...|               .|::.:....|:.||:
Mosquito    35 KSVTEENLREHFDKFGDIEEIWIVKDRATGEGKGITEQLEKEEQEGARRVAYIKYAKTSDAARAL 99

  Fly   176 KVLNG-----------ITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSI 229
            :.:||           :.|...|.:.|..:...|..|...|:|. :|:.:|::.|...|||||::
Mosquito   100 EEMNGKCVGDNTRPIKVLVA
ANRQQGSRKQTENEEEKYLRLFVI-IPKDMTEEALREEFGKYGTV 163

  Fly   230 VQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMS 294
            ....|:|||:|...:|.|:|::.:...|.:|..         |..|          |.||..   
Mosquito   164 DLVTIIRDKVTKEGKGFAYVKFGRFLHAAQAFE---------GCDP----------KYKAVF--- 206

  Fly   295 QMGVVPANVPPPPPQPPAHMAAAFN 319
                       ..|:||.:.:.:.|
Mosquito   207 -----------AEPKPPRNASVSSN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 19/96 (20%)
RRM2_Hu_like 203..281 CDD:240822 22/77 (29%)
AgaP_AGAP005505XP_315504.4 RRM1_RBM45 24..119 CDD:240812 16/83 (19%)
RRM_SF 137..210 CDD:302621 25/106 (24%)
RRM_SF 281..351 CDD:302621
RRM_SF 422..489 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.