DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AgaP_AGAP004950

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_315047.4 Gene:AgaP_AGAP004950 / 1275761 VectorBaseID:AGAP004950 Length:354 Species:Anopheles gambiae


Alignment Length:146 Identity:39/146 - (26%)
Similarity:53/146 - (36%) Gaps:52/146 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNY 123
            ||||..||..|                          |                     ||.:.:
Mosquito   258 FPGCSISGPEG--------------------------C---------------------NLFIYH 275

  Fly   124 LPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRL 188
            |||:..|.||..:|...|.:.:.::..|..|..|..:.||.|.:...:|.||:.:||..:..|||
Mosquito   276 LPQEFGDGELMQMFMPFGTVISSKVFIDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRL 340

  Fly   189 KVSYARPGGESIKDTN 204
            ||...||     ||.|
Mosquito   341 KVQLKRP-----KDAN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 28/79 (35%)
RRM2_Hu_like 203..281 CDD:240822 1/2 (50%)
AgaP_AGAP004950XP_315047.4 RRM2_CELF3_4_5_6 2..82 CDD:241079
ELAV_HUD_SF 5..350 CDD:273741 37/143 (26%)
RRM3_CELF3_4_5_6 265..343 CDD:241083 28/124 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.