DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sxl and AgaP_AGAP010496

DIOPT Version :9

Sequence 1:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster
Sequence 2:XP_314469.4 Gene:AgaP_AGAP010496 / 1275237 VectorBaseID:AGAP010496 Length:258 Species:Anopheles gambiae


Alignment Length:175 Identity:38/175 - (21%)
Similarity:66/175 - (37%) Gaps:38/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITV 183
            :.|..||.|:..:::..||...|.:.    ..|.|......:|||:|....|:..|:|..:|...
Mosquito    10 IYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDY 70

  Fly   184 RNKRLKVSYARPGG--------ESIKDTN-------------------LYVTNLPRTITDDQLDT 221
            ...||:|.:.|.||        :...|.|                   :.||.||.:.:...|..
Mosquito    71 DGYRLRVEFPRGGGPGSYRGSRQGNSDRNSRGGDRNNRGPPARRSQFRVMVTGLPSSGSWQDLKD 135

  Fly   222 IFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNN 266
            ...:.|.:...::.:|       |...|.:.:.|:.:.||..|::
Mosquito   136 HMREAGDVCFADVYKD-------GTGVVEFLRHEDMKYAIKKLDD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 21/77 (27%)
RRM2_Hu_like 203..281 CDD:240822 14/83 (17%)
AgaP_AGAP010496XP_314469.4 RRM <1..183 CDD:223796 38/175 (22%)
RRM1_SRSF1 9..81 CDD:241041 20/74 (27%)
RRM2_SRSF1_like 117..180 CDD:241045 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.